(data stored in ACNUC1104 zone)

EMBL: FN667741.PE387

FN667741.PE387       Location/Qualifiers
FT   CDS             complement(402460..402846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0079"
FT                   /locus_tag="XBJ1_0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79542"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79542.1"
FT                   /translation="MSRSIHTENAPAAIGPYVQGVDLGSMVITSGQIPVDPKTGDIPED
FT                   ITAQTRQSLENVKAIIEQSGLKVADIVKTTVFVKDLNDFTTVNAAYETFFTEHNAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRS"
     MSRSIHTENA PAAIGPYVQG VDLGSMVITS GQIPVDPKTG DIPEDITAQT RQSLENVKAI        60
     IEQSGLKVAD IVKTTVFVKD LNDFTTVNAA YETFFTEHNA PFPARSCVEV ARLPKDVKIE       120
     IEAIAVRS                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page