(data stored in ACNUC1104 zone)

EMBL: FN667741.PE397

FN667741.PE397       Location/Qualifiers
FT   CDS             complement(411661..412398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0402"
FT                   /product="Regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79552"
FT                   /db_xref="GOA:D3UZ24"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79552.1"
FT                   /translation="MIFNQKEMNIIQARDFMNEILVSKTTTNILRQMIQKDTVIKSPIG
FT                   TYVGIESFIALLKIWHRAFPNLVYKENNLYVHNENIIIDWEAEGKHLGEFYSISATGKQ
FT                   VTCQGTTEIVMNDGKIIDYHTKINIQNIISQLIGLPCSPTLDIRNIEIYNLINNILGYQ
FT                   LSCRQIECLSLSTLNTSIKEIARLLSIESNTVKTHLKRAFEIIGISNKKMLMEFIIERQ
FT                   AIEILVRLGLFLRVQIKRNNYFE"
     MIFNQKEMNI IQARDFMNEI LVSKTTTNIL RQMIQKDTVI KSPIGTYVGI ESFIALLKIW        60
     HRAFPNLVYK ENNLYVHNEN IIIDWEAEGK HLGEFYSISA TGKQVTCQGT TEIVMNDGKI       120
     IDYHTKINIQ NIISQLIGLP CSPTLDIRNI EIYNLINNIL GYQLSCRQIE CLSLSTLNTS       180
     IKEIARLLSI ESNTVKTHLK RAFEIIGISN KKMLMEFIIE RQAIEILVRL GLFLRVQIKR       240
     NNYFE                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page