(data stored in ACNUC1104 zone)

EMBL: FN667741.PE398

FN667741.PE398       Location/Qualifiers
FT   CDS             complement(412776..413219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0403"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79553"
FT                   /db_xref="GOA:D3UZ25"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79553.1"
FT                   /translation="MLNGTQLRYAALIARYSLAIAYLVAVADRFGLCGEYGDPQITWGN
FT                   FTVFLGVVKHLTPWAPDFMIPIFGWGATILEVALPIFLIIGFKIKETALVSAALLLIFA
FT                   VTMTTTGLLKSVFDYSVLSAFSCSLLLYCFEKFRVSEDKKQLN"
     MLNGTQLRYA ALIARYSLAI AYLVAVADRF GLCGEYGDPQ ITWGNFTVFL GVVKHLTPWA        60
     PDFMIPIFGW GATILEVALP IFLIIGFKIK ETALVSAALL LIFAVTMTTT GLLKSVFDYS       120
     VLSAFSCSLL LYCFEKFRVS EDKKQLN                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page