(data stored in ACNUC1104 zone)

EMBL: FN667741.PE399

FN667741.PE399       Location/Qualifiers
FT   CDS             complement(413332..413754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0081"
FT                   /locus_tag="XBJ1_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79554"
FT                   /db_xref="GOA:D3UZ26"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79554.1"
FT                   /translation="MNYAKISPKIMNPLYKCYDEIQKCELDQSLILLVEMRTSQINGCA
FT                   YCCRLHAEMGRKLGIEEEKLDKLPGWFNSRIYNQKEVLALEWCEALTIGLRDKDLNDLR
FT                   ERLEELFSEKELVDLTSAISVMNALNRMAISIGDHS"
     MNYAKISPKI MNPLYKCYDE IQKCELDQSL ILLVEMRTSQ INGCAYCCRL HAEMGRKLGI        60
     EEEKLDKLPG WFNSRIYNQK EVLALEWCEA LTIGLRDKDL NDLRERLEEL FSEKELVDLT       120
     SAISVMNALN RMAISIGDHS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page