(data stored in ACNUC1104 zone)

EMBL: FN667741.PE411

FN667741.PE411       Location/Qualifiers
FT   CDS             427353..428927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0416"
FT                   /product="Band 7 protein (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79566"
FT                   /db_xref="GOA:D3UZ38"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79566.1"
FT                   /translation="MMKKIKLLQGQIGLLAKEGEYQQILTAGKYRFIDWFNKLRLTVFE
FT                   LNSNEIEAKLAEHLRQYHTDWVAQHCDDIQLTEDEIGLLYEHDLLTEILPPATRRLYWK
FT                   NGDQRRIEVCPTTEQEVSSQLVSLLQPSKIRKRNVKGLESVLITQIPAWHIGVLKSDGI
FT                   VQQLLQPGLKGYWRFGHDISVELVDTRSWPQVEESLAEYFRHQHIDWVEQYCDEIQIAD
FT                   DEMGLLYEHDVLVEILSPATRYLYWKNGNPRCVEVLKASELEVSSELASVLVSSMVRKH
FT                   SVKGIDSVLIAQVPAWHVGILKVDGVAQKLLQPGQAGYWQVGHDVTVEIVDTRLQALEV
FT                   GGQEILTRDKVNLRINLSANWRYHDVLMAYEQLSEPVAYLYRELQFALREMVGTRSLDE
FT                   LLEDKQAIDELINEKVQRITAGFGLEVVSLGVKDIILPGEMKTILSRVVEAEKAAQANV
FT                   IRRREETAATRSLLNTAKVMENNPIALRLKELETLESIAERINQISVYGGLDQVLNGLV
FT                   QIKGEQK"
     MMKKIKLLQG QIGLLAKEGE YQQILTAGKY RFIDWFNKLR LTVFELNSNE IEAKLAEHLR        60
     QYHTDWVAQH CDDIQLTEDE IGLLYEHDLL TEILPPATRR LYWKNGDQRR IEVCPTTEQE       120
     VSSQLVSLLQ PSKIRKRNVK GLESVLITQI PAWHIGVLKS DGIVQQLLQP GLKGYWRFGH       180
     DISVELVDTR SWPQVEESLA EYFRHQHIDW VEQYCDEIQI ADDEMGLLYE HDVLVEILSP       240
     ATRYLYWKNG NPRCVEVLKA SELEVSSELA SVLVSSMVRK HSVKGIDSVL IAQVPAWHVG       300
     ILKVDGVAQK LLQPGQAGYW QVGHDVTVEI VDTRLQALEV GGQEILTRDK VNLRINLSAN       360
     WRYHDVLMAY EQLSEPVAYL YRELQFALRE MVGTRSLDEL LEDKQAIDEL INEKVQRITA       420
     GFGLEVVSLG VKDIILPGEM KTILSRVVEA EKAAQANVIR RREETAATRS LLNTAKVMEN       480
     NPIALRLKEL ETLESIAERI NQISVYGGLD QVLNGLVQIK GEQK                        524
//

If you have problems or comments...

PBIL Back to PBIL home page