(data stored in ACNUC1104 zone)

EMBL: FN667741.PE413

FN667741.PE413       Location/Qualifiers
FT   CDS             430183..430989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0084"
FT                   /locus_tag="XBJ1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79568"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79568.1"
FT                   /translation="MEVMEKKTTAVSSVMRTRIKQELAGIEKRYGVQILYACESGSRGW
FT                   GFASPDSDYDVRFIYVHPVDWYLIVEAGRDVIELPISDELDICGWELRKTLKLLKQANP
FT                   TLMEWLDSPIIYQADPAATNGLKTMVPHFFSGIKARYHYLSMAKKNFRGYLQGEEVRLK
FT                   KYFYVLRPLLAVRWIEMGKGVPPIDFETLVAGTVDDPQLKAEISDLLRSKRLANESEYG
FT                   LRKLRVHAFIESELDETLSRCELKDKRERSYALLDDYLRRWVMKRV"
     MEVMEKKTTA VSSVMRTRIK QELAGIEKRY GVQILYACES GSRGWGFASP DSDYDVRFIY        60
     VHPVDWYLIV EAGRDVIELP ISDELDICGW ELRKTLKLLK QANPTLMEWL DSPIIYQADP       120
     AATNGLKTMV PHFFSGIKAR YHYLSMAKKN FRGYLQGEEV RLKKYFYVLR PLLAVRWIEM       180
     GKGVPPIDFE TLVAGTVDDP QLKAEISDLL RSKRLANESE YGLRKLRVHA FIESELDETL       240
     SRCELKDKRE RSYALLDDYL RRWVMKRV                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page