(data stored in ACNUC1104 zone)

EMBL: FN667741.PE416

FN667741.PE416       Location/Qualifiers
FT   CDS             432254..432373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0421"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79571"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79571.1"
FT                   /translation="MFLWVAFIVAAPAVRESLQAEQVLKLQLQAEALARPEPV"
     MFLWVAFIVA APAVRESLQA EQVLKLQLQA EALARPEPV                               39
//

If you have problems or comments...

PBIL Back to PBIL home page