(data stored in ACNUC1104 zone)

EMBL: FN667741.PE418

FN667741.PE418       Location/Qualifiers
FT   CDS             complement(433048..433302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79573"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79573.1"
FT                   /translation="MSGVGLHSIAGVVEQISDPILGGGSFRSNGAVKALIELDVILQGP
FT                   KIGRNHSYRLNPQFGWKGMVNNHKETLTNGLSVIQGGRA"
     MSGVGLHSIA GVVEQISDPI LGGGSFRSNG AVKALIELDV ILQGPKIGRN HSYRLNPQFG        60
     WKGMVNNHKE TLTNGLSVIQ GGRA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page