(data stored in ACNUC1104 zone)

EMBL: FN667741.PE430

FN667741.PE430       Location/Qualifiers
FT   CDS             complement(442204..442977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0435"
FT                   /product="putative cysteine transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79585"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79585.1"
FT                   /translation="MNIILNILLATIIQLGITQLAYAKSTLDNIQSTGVFRIGTEGAYA
FT                   PFSYHDASGKLTGFDVEIGREIALRMKVKPEFIEGKWDGLIGGLDAGRSDAVMNQIAIT
FT                   PEREKKYSFSLPYVISEAVLITRKDNNDIKTFRDLKGRTSSHTLTNNFAQIARHYGAEI
FT                   IGTNGFSQEVELVSTGRADATINDKLSYLDYKKHRPDAPVKIVAADTNAAQTAVLLRKS
FT                   DPELKAAVDKAITEIKNDGTYQQIWDNYFGGEVAE"
     MNIILNILLA TIIQLGITQL AYAKSTLDNI QSTGVFRIGT EGAYAPFSYH DASGKLTGFD        60
     VEIGREIALR MKVKPEFIEG KWDGLIGGLD AGRSDAVMNQ IAITPEREKK YSFSLPYVIS       120
     EAVLITRKDN NDIKTFRDLK GRTSSHTLTN NFAQIARHYG AEIIGTNGFS QEVELVSTGR       180
     ADATINDKLS YLDYKKHRPD APVKIVAADT NAAQTAVLLR KSDPELKAAV DKAITEIKND       240
     GTYQQIWDNY FGGEVAE                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page