(data stored in ACNUC1104 zone)

EMBL: FN667741.PE434

FN667741.PE434       Location/Qualifiers
FT   CDS             444563..444697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79589"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79589.1"
FT                   /translation="MAYSEYNSTWLLYVKWPIRYVDYHCENRIFPDKGLPQGMEFKAL"
     MAYSEYNSTW LLYVKWPIRY VDYHCENRIF PDKGLPQGME FKAL                         44
//

If you have problems or comments...

PBIL Back to PBIL home page