(data stored in ACNUC1104 zone)

EMBL: FN667741.PE438

FN667741.PE438       Location/Qualifiers
FT   CDS             445422..445676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79593"
FT                   /db_xref="GOA:D3UW84"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79593.1"
FT                   /translation="MPSQRLCSFYILNNKPNVSTLSIHYSLLSGVRFKSLTDAIDTGMS
FT                   SDRSFFHVMAGLAEMERELTVESIRAGRETVKKHKIKFI"
     MPSQRLCSFY ILNNKPNVST LSIHYSLLSG VRFKSLTDAI DTGMSSDRSF FHVMAGLAEM        60
     ERELTVESIR AGRETVKKHK IKFI                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page