(data stored in ACNUC1104 zone)

EMBL: FN667741.PE446

FN667741.PE446       Location/Qualifiers
FT   CDS             454618..454776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79601"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79601.1"
FT                   /translation="MLFLFLKQRDDSANNDTHKDTYKNIADNRHDCLPQSGMLLWNYIR
FT                   CLKVVYW"
     MLFLFLKQRD DSANNDTHKD TYKNIADNRH DCLPQSGMLL WNYIRCLKVV YW                52
//

If you have problems or comments...

PBIL Back to PBIL home page