(data stored in ACNUC1104 zone)

EMBL: FN667741.PE449

FN667741.PE449       Location/Qualifiers
FT   CDS             complement(459232..461028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79604"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79604.1"
FT                   /translation="MLNPNNRSLYTSALTSPPGMVFDEAIATSFSLDPAFLLQAPVYLA
FT                   FTATDSNRAQDPLSIFEAIRRYSERITVYVQKGRIQVPTKLKPNPLFGLLEDMIVESKA
FT                   KGRGVFHPKIWAIRFINPETDEVMYRLVVLSRNLTTDSSWDLSLQLDGYPVKRKQSANK
FT                   ALVHLFSVLPKRATGKMAKHRRKQAQRFADELLYIEWECPAGFDKVAFFLPGEGYEWKP
FT                   PEADRAVVISPFCTDEALRHIVEHCQQADALISRPDTLLALSKKTLNLFTRQLHLDDAA
FT                   EGQMHDESSPDEIIASGLHAKAYLFENGRDSELVLGSANATSAALLGKTNCEILVSLKG
FT                   KKKHTGTIDDLLSSDGMGSYLQDFDPAQPFEPDALRVKAECHLEQARTLLAEATLSLHG
FT                   HPGQNDQSWALWLIGEIPKLPGVVQATAWPITVSEVLSCNLQDPNKENKRELGEFSVQA
FT                   ITGLTAFSLKTSHPDVSLRFVLNLPIDSLPPDHNAMILQSSMRNQDFLRYLLMLIGETG
FT                   HQSFFAENTFGDGHFFTGLANGEEFSVLEELTRIYSREPERLNDIAALVENMRKGKNDM
FT                   IPQDFLALWAVFESAMGGRYGR"
     MLNPNNRSLY TSALTSPPGM VFDEAIATSF SLDPAFLLQA PVYLAFTATD SNRAQDPLSI        60
     FEAIRRYSER ITVYVQKGRI QVPTKLKPNP LFGLLEDMIV ESKAKGRGVF HPKIWAIRFI       120
     NPETDEVMYR LVVLSRNLTT DSSWDLSLQL DGYPVKRKQS ANKALVHLFS VLPKRATGKM       180
     AKHRRKQAQR FADELLYIEW ECPAGFDKVA FFLPGEGYEW KPPEADRAVV ISPFCTDEAL       240
     RHIVEHCQQA DALISRPDTL LALSKKTLNL FTRQLHLDDA AEGQMHDESS PDEIIASGLH       300
     AKAYLFENGR DSELVLGSAN ATSAALLGKT NCEILVSLKG KKKHTGTIDD LLSSDGMGSY       360
     LQDFDPAQPF EPDALRVKAE CHLEQARTLL AEATLSLHGH PGQNDQSWAL WLIGEIPKLP       420
     GVVQATAWPI TVSEVLSCNL QDPNKENKRE LGEFSVQAIT GLTAFSLKTS HPDVSLRFVL       480
     NLPIDSLPPD HNAMILQSSM RNQDFLRYLL MLIGETGHQS FFAENTFGDG HFFTGLANGE       540
     EFSVLEELTR IYSREPERLN DIAALVENMR KGKNDMIPQD FLALWAVFES AMGGRYGR         598
//

If you have problems or comments...

PBIL Back to PBIL home page