(data stored in ACNUC1104 zone)

EMBL: FN667741.PE450

FN667741.PE450       Location/Qualifiers
FT   CDS             complement(461022..462248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0090"
FT                   /locus_tag="XBJ1_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79605"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79605.1"
FT                   /translation="MASALGWLDHDADTQAKTLNILALFQQKESRDELGIGSIRDSFAE
FT                   QLFPGTSTIQTRLRYMLFVPWIYLRLENKRIPAANFGTQADRDERALIITLSRLEDSAG
FT                   TFGKNSREKLKRLPSSVYWSGLRRWGIRETMWSQEEYHRRVDELYRERTEISEREYLEK
FT                   NRGDMGDTSAYKPAQSWHSSLPAPPPNFPNDATFALTRQEASFLRDRIQLSCKGSLLAW
FT                   LTLHSEPADVSSPWEHPDYARFPDELKELLTHARLFSYTMHGAALLYNYLLAKERSDND
FT                   LLSQHNNNFVDWFTALPRKEIATWSLGRMWELTAEPGYSISLKTRRFVEQWIALIQQSP
FT                   VTLLTSKEACDLIRAREITLKGPRSRFKNRRSLEQWSGYAGTLRLVYRWHNVQIVLKDL
FT                   AHGLRREEC"
     MASALGWLDH DADTQAKTLN ILALFQQKES RDELGIGSIR DSFAEQLFPG TSTIQTRLRY        60
     MLFVPWIYLR LENKRIPAAN FGTQADRDER ALIITLSRLE DSAGTFGKNS REKLKRLPSS       120
     VYWSGLRRWG IRETMWSQEE YHRRVDELYR ERTEISEREY LEKNRGDMGD TSAYKPAQSW       180
     HSSLPAPPPN FPNDATFALT RQEASFLRDR IQLSCKGSLL AWLTLHSEPA DVSSPWEHPD       240
     YARFPDELKE LLTHARLFSY TMHGAALLYN YLLAKERSDN DLLSQHNNNF VDWFTALPRK       300
     EIATWSLGRM WELTAEPGYS ISLKTRRFVE QWIALIQQSP VTLLTSKEAC DLIRAREITL       360
     KGPRSRFKNR RSLEQWSGYA GTLRLVYRWH NVQIVLKDLA HGLRREEC                    408
//

If you have problems or comments...

PBIL Back to PBIL home page