(data stored in ACNUC1104 zone)

EMBL: FN667741.PE462

FN667741.PE462       Location/Qualifiers
FT   CDS             complement(468698..468970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0468"
FT                   /product="chromosome replication (initiation and chain
FT                   elongation) with nucleoside triP hydrolase domain
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79617"
FT                   /db_xref="GOA:D3UWA8"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79617.1"
FT                   /translation="MLQELSTVDLLVIDEIGMQIESRYEKVTINQIVDRRSSSKRPTGM
FT                   LSNLDMNGMNTLLGERVMDRMRLGDSLWVIFNWGSYRSRIKGNEY"
     MLQELSTVDL LVIDEIGMQI ESRYEKVTIN QIVDRRSSSK RPTGMLSNLD MNGMNTLLGE        60
     RVMDRMRLGD SLWVIFNWGS YRSRIKGNEY                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page