(data stored in ACNUC1104 zone)

EMBL: FN667741.PE481

FN667741.PE481       Location/Qualifiers
FT   CDS             complement(486148..487530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0487"
FT                   /product="Alkaline protease secretion protein aprF"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79636"
FT                   /db_xref="GOA:D3UWC7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79636.1"
FT                   /translation="MFRSYSVTGRVLFLPLFLLMLFSGTVQALSLTEAYALALQHDPTF
FT                   QAAIKAQEAGQEEKNLGRAELLPKLAFNYQYVPQNWQKMESSSSASGQRGNMITESRNR
FT                   QYHSYSGSLVLTQPLVDFEAWARYKTRQAYVLMSDARFRVDTQQLAVRVVNSYVDVAYA
FT                   QDRQAQVAQQRRAYEEQLERNQKLFASGEGTRTDVAETQAHYSQVVADELTVKDELDAA
FT                   IRDLQLLVGIPLPDDLPVNRLSPVQNFKIIKLAFAHYADWEQIALSQNPQLAEARQKVA
FT                   VAAQDIERNRAGYLPKLELYASHTENKSSSDNIVDQKYRTDSIGLRVSMNLYNGGGTSA
FT                   AVRQSAANYSKAKYEMDAEAGETLNALRRNYNACMNGEKRIRAYESAVEAAELQVKATQ
FT                   KSVALGQRVNVDILNAEQQLYIARRDLSQAKYQYMKSWIGLLSEAGQLNGEHIQLASGY
FT                   FE"
     MFRSYSVTGR VLFLPLFLLM LFSGTVQALS LTEAYALALQ HDPTFQAAIK AQEAGQEEKN        60
     LGRAELLPKL AFNYQYVPQN WQKMESSSSA SGQRGNMITE SRNRQYHSYS GSLVLTQPLV       120
     DFEAWARYKT RQAYVLMSDA RFRVDTQQLA VRVVNSYVDV AYAQDRQAQV AQQRRAYEEQ       180
     LERNQKLFAS GEGTRTDVAE TQAHYSQVVA DELTVKDELD AAIRDLQLLV GIPLPDDLPV       240
     NRLSPVQNFK IIKLAFAHYA DWEQIALSQN PQLAEARQKV AVAAQDIERN RAGYLPKLEL       300
     YASHTENKSS SDNIVDQKYR TDSIGLRVSM NLYNGGGTSA AVRQSAANYS KAKYEMDAEA       360
     GETLNALRRN YNACMNGEKR IRAYESAVEA AELQVKATQK SVALGQRVNV DILNAEQQLY       420
     IARRDLSQAK YQYMKSWIGL LSEAGQLNGE HIQLASGYFE                             460
//

If you have problems or comments...

PBIL Back to PBIL home page