(data stored in ACNUC1104 zone)

EMBL: FN667741.PE482

FN667741.PE482       Location/Qualifiers
FT   CDS             complement(487536..488873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0488"
FT                   /product="Alkaline protease secretion protein aprE"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79637"
FT                   /db_xref="GOA:D3UWC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79637.1"
FT                   /translation="MSYQTNAKSAKNDESGLLPLDANRYLRLGWLVIGIGLLGFFVWAA
FT                   FAPLDKGVASSGIVVVDGNRKTVQSPANGIIRQILASEGEQVKAGQVLVQLSQVQVNAQ
FT                   IDSLKQQLHTTLATEARLLAEQQGLEVISFPATLWDQQSEPRIKDILVLQKQLFLSRRE
FT                   MLRSDLAGMQQAEEGLSFQLKGLRNALTNKQQQQVSLKEQVTNLRPLTEEGYFPRNRYL
FT                   ELQRSQSELSGSMAEMAGRIGQLEKQCQETRQRIIQRQADYQREVRSQLSDVQVQANEL
FT                   KNKLETTQFDLSHTSITAPVSGSVMGLTVFTQGGVVASGEKLMEILPAQSALEVEARLM
FT                   VHLIDKVAMGQDVDLMFTAFNQNQTPKVTGKVTVISADRLVDGVTREPYYQMRVRVTPE
FT                   GMAQLAGLHIKPGMPVEVFVKTGSRSLLSYLFKPLMDRASTSLIEE"
     MSYQTNAKSA KNDESGLLPL DANRYLRLGW LVIGIGLLGF FVWAAFAPLD KGVASSGIVV        60
     VDGNRKTVQS PANGIIRQIL ASEGEQVKAG QVLVQLSQVQ VNAQIDSLKQ QLHTTLATEA       120
     RLLAEQQGLE VISFPATLWD QQSEPRIKDI LVLQKQLFLS RREMLRSDLA GMQQAEEGLS       180
     FQLKGLRNAL TNKQQQQVSL KEQVTNLRPL TEEGYFPRNR YLELQRSQSE LSGSMAEMAG       240
     RIGQLEKQCQ ETRQRIIQRQ ADYQREVRSQ LSDVQVQANE LKNKLETTQF DLSHTSITAP       300
     VSGSVMGLTV FTQGGVVASG EKLMEILPAQ SALEVEARLM VHLIDKVAMG QDVDLMFTAF       360
     NQNQTPKVTG KVTVISADRL VDGVTREPYY QMRVRVTPEG MAQLAGLHIK PGMPVEVFVK       420
     TGSRSLLSYL FKPLMDRAST SLIEE                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page