(data stored in ACNUC1104 zone)

EMBL: FN667741.PE483

FN667741.PE483       Location/Qualifiers
FT   CDS             complement(488946..490673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0094"
FT                   /locus_tag="XBJ1_0489"
FT                   /product="Alkaline protease secretion ATP-binding protein
FT                   aprD"
FT                   /EC_number="3.6.3.43"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79638"
FT                   /db_xref="GOA:D3UWC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79638.1"
FT                   /translation="MKLRFPKDEITDVIRARSKVFWTIGLFTAFINLLMLVPSIYMLQV
FT                   YDRVLPSSNEMTLLMLTLITLGMFAIMGGLEYIRSMVVIRIGSQFDMCLNQRVYTASYE
FT                   SNLKNGSTDAGQMLNDLATIRQFLTGNALFAFFDVPWFPIYLWVIFLFSPYLGLLALVG
FT                   AIILITLAVLNQWLSQSPLSEASHLSLRSANLASTNLRNAEVIEALGMLPALRQRWFSL
FT                   HERFLNFQRIASERAASITALTKTVRMALQSLILGLGGWLAIEGNITPGMMITGSILMG
FT                   RALSPIEQLIQAWKSWSAARLSWQRLDKLLKAQPERKSGMSLPAPKGILLLEKVAAIPP
FT                   SKTQARQTAGNHKQVLQDISFSLNAGDVLGVIGPSASGKSTLARLLVGIWPSQEGVVRL
FT                   DDADIYQWNKDELGASIGYLPQDIELFGGTIAENIARFNDVDPEKVIEAAKKAGVHELV
FT                   LNLEQGYDTVIGTGGMGLSGGQKQRIGLARALYGNPSLLVLDEPNSNLDDIGEKALSQA
FT                   ITQLREQGKTVVVITHRPSLLSQTNKILLLVQGKMKMFGPSQQVMAALSQSKTVERAS"
     MKLRFPKDEI TDVIRARSKV FWTIGLFTAF INLLMLVPSI YMLQVYDRVL PSSNEMTLLM        60
     LTLITLGMFA IMGGLEYIRS MVVIRIGSQF DMCLNQRVYT ASYESNLKNG STDAGQMLND       120
     LATIRQFLTG NALFAFFDVP WFPIYLWVIF LFSPYLGLLA LVGAIILITL AVLNQWLSQS       180
     PLSEASHLSL RSANLASTNL RNAEVIEALG MLPALRQRWF SLHERFLNFQ RIASERAASI       240
     TALTKTVRMA LQSLILGLGG WLAIEGNITP GMMITGSILM GRALSPIEQL IQAWKSWSAA       300
     RLSWQRLDKL LKAQPERKSG MSLPAPKGIL LLEKVAAIPP SKTQARQTAG NHKQVLQDIS       360
     FSLNAGDVLG VIGPSASGKS TLARLLVGIW PSQEGVVRLD DADIYQWNKD ELGASIGYLP       420
     QDIELFGGTI AENIARFNDV DPEKVIEAAK KAGVHELVLN LEQGYDTVIG TGGMGLSGGQ       480
     KQRIGLARAL YGNPSLLVLD EPNSNLDDIG EKALSQAITQ LREQGKTVVV ITHRPSLLSQ       540
     TNKILLLVQG KMKMFGPSQQ VMAALSQSKT VERAS                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page