(data stored in ACNUC1104 zone)

EMBL: FN667741.PE495

FN667741.PE495       Location/Qualifiers
FT   CDS             504032..504172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79650"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79650.1"
FT                   /translation="MALFESYTQSVILDYECDFYHKIMYVFLYLYQLKMIFITKKCQIR
FT                   H"
     MALFESYTQS VILDYECDFY HKIMYVFLYL YQLKMIFITK KCQIRH                       46
//

If you have problems or comments...

PBIL Back to PBIL home page