(data stored in ACNUC1104 zone)

EMBL: FN667741.PE497

FN667741.PE497       Location/Qualifiers
FT   CDS             505103..505885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0098"
FT                   /locus_tag="XBJ1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79652"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79652.1"
FT                   /translation="MTTTLLSHPSLLPLHGGINFRDFGNKTLHNGAKIKSGLLFRSGSL
FT                   DMLTENDQTFLMSKNLFQIIDYRDSSEIEDKPDRVWRGANYHHAPANPLSKEVDANLEK
FT                   LGQERLEQFDERAFMLRLYELLPISNPAYKKLANLLVQPEKGGILQHCAVGKDRTGVGS
FT                   ALVLFALGADLDTVMEDYLVTNVTLAPYREYLLNEHAKVMSDRVIEKFAYVYSVQEEFL
FT                   LTALNSINQHYGSVDIWLEKDIGLDMTAREKLQSYFLE"
     MTTTLLSHPS LLPLHGGINF RDFGNKTLHN GAKIKSGLLF RSGSLDMLTE NDQTFLMSKN        60
     LFQIIDYRDS SEIEDKPDRV WRGANYHHAP ANPLSKEVDA NLEKLGQERL EQFDERAFML       120
     RLYELLPISN PAYKKLANLL VQPEKGGILQ HCAVGKDRTG VGSALVLFAL GADLDTVMED       180
     YLVTNVTLAP YREYLLNEHA KVMSDRVIEK FAYVYSVQEE FLLTALNSIN QHYGSVDIWL       240
     EKDIGLDMTA REKLQSYFLE                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page