(data stored in ACNUC1104 zone)

EMBL: FN667741.PE498

FN667741.PE498       Location/Qualifiers
FT   CDS             505963..506493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0098"
FT                   /locus_tag="XBJ1_0504"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79653"
FT                   /db_xref="GOA:D3UZ71"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79653.1"
FT                   /translation="MSLHEIIELVTDFVKAHEYWAIPIVFLLAFGESLAFISLLLPATI
FT                   ILLGLGALIGESGLNFWPIWIAAAAGAFFGDWVSYLFGAHYKDNVGKMWPLSRHPQMLV
FT                   RGHRFFERWGVWGVFIGRFFGPLRAVIPLVAGICAMPKRHFQLANFASALIWAFGILAP
FT                   GAFGLRWLAEWMG"
     MSLHEIIELV TDFVKAHEYW AIPIVFLLAF GESLAFISLL LPATIILLGL GALIGESGLN        60
     FWPIWIAAAA GAFFGDWVSY LFGAHYKDNV GKMWPLSRHP QMLVRGHRFF ERWGVWGVFI       120
     GRFFGPLRAV IPLVAGICAM PKRHFQLANF ASALIWAFGI LAPGAFGLRW LAEWMG           176
//

If you have problems or comments...

PBIL Back to PBIL home page