(data stored in ACNUC1104 zone)

EMBL: FN667741.PE499

FN667741.PE499       Location/Qualifiers
FT   CDS             506613..507968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /locus_tag="XBJ1_0505"
FT                   /product="DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79654"
FT                   /db_xref="GOA:D3UZ72"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79654.1"
FT                   /translation="MDIQWLYMLIGSLSGLLGGGIFVWLSVHQRIQQKELELRELHSQL
FT                   AISHEKLEQSHYWRTECDQLNQELLAQREINSVQEVELRELSTRLEESRLAAEEKQRLL
FT                   INSEQRLNTQFENLANRIFEQNRRRTDEYSRQSLNDLLMPFREQLDGFRSQVQDSFGQE
FT                   ARERHTLTHEIRNLQQLNAQMAKEAINLTKALKGDNKMQGDWGEMVLARVLESSGLREG
FT                   YEFHTQVNIKTENGERFQPDVIVHLPQEKDVIIDAKMSLIAYERYFNSDDDTQQAQALQ
FT                   EHINSIKGHIRGLSRKDYQQLPGLRSLDYVLMFIPIEPAYLVALNQAPELLDEALKHNI
FT                   MLVSPSTLLVAVRTINNLWRYEYQSQNARLIADKATRMYDKMRLFVDDMQGLGHSLNKA
FT                   QESYHLAMKKLAEGRGNLISQAEGFRDLGVDVKRPIDSQLIDKSFQSLQVNE"
     MDIQWLYMLI GSLSGLLGGG IFVWLSVHQR IQQKELELRE LHSQLAISHE KLEQSHYWRT        60
     ECDQLNQELL AQREINSVQE VELRELSTRL EESRLAAEEK QRLLINSEQR LNTQFENLAN       120
     RIFEQNRRRT DEYSRQSLND LLMPFREQLD GFRSQVQDSF GQEARERHTL THEIRNLQQL       180
     NAQMAKEAIN LTKALKGDNK MQGDWGEMVL ARVLESSGLR EGYEFHTQVN IKTENGERFQ       240
     PDVIVHLPQE KDVIIDAKMS LIAYERYFNS DDDTQQAQAL QEHINSIKGH IRGLSRKDYQ       300
     QLPGLRSLDY VLMFIPIEPA YLVALNQAPE LLDEALKHNI MLVSPSTLLV AVRTINNLWR       360
     YEYQSQNARL IADKATRMYD KMRLFVDDMQ GLGHSLNKAQ ESYHLAMKKL AEGRGNLISQ       420
     AEGFRDLGVD VKRPIDSQLI DKSFQSLQVN E                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page