(data stored in ACNUC1104 zone)

EMBL: FN667741.PE501

FN667741.PE501       Location/Qualifiers
FT   CDS             508801..509451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0099"
FT                   /locus_tag="XBJ1_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79656"
FT                   /db_xref="GOA:D3UZ74"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79656.1"
FT                   /translation="METPELSDNLNSTVLFPVLTAFLETTLNHLLYRETVLKSSRMRLA
FT                   GKVLSIELKEIKTPLVLIFSEKQVDVLSQWSESADCSMKTTFTALLKLRDRHCLSSLIN
FT                   SGEIVIEGDMQVMQQWSALLDMSEWDPAHYLSPYVGDIVAEGLSRVMKGSIKLASNAIT
FT                   RQKTYLTESLTEEWRVAPNPLEVAYFSEEVNAVANDMSHMEKRLAALEGKYDS"
     METPELSDNL NSTVLFPVLT AFLETTLNHL LYRETVLKSS RMRLAGKVLS IELKEIKTPL        60
     VLIFSEKQVD VLSQWSESAD CSMKTTFTAL LKLRDRHCLS SLINSGEIVI EGDMQVMQQW       120
     SALLDMSEWD PAHYLSPYVG DIVAEGLSRV MKGSIKLASN AITRQKTYLT ESLTEEWRVA       180
     PNPLEVAYFS EEVNAVANDM SHMEKRLAAL EGKYDS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page