(data stored in ACNUC1104 zone)

EMBL: FN667741.PE517

FN667741.PE517       Location/Qualifiers
FT   CDS             complement(530295..530960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0104"
FT                   /locus_tag="XBJ1_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79672"
FT                   /db_xref="GOA:D3UZ90"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79672.1"
FT                   /translation="MTMKKENSPQILSKKIAETIRNKLVIGELLPGQRLSEAILSEQLE
FT                   ISRNTLREVFRVLTQEGLLKHQPNRGVFVAIPDIASIIDIYQVRRLIECQALTQAYSMH
FT                   PSVAKMKEAVTSAQLYRNNQNWVGVGTANMHFHTAIVELTDSKRLITFYRNISAELRLA
FT                   FGLLNDPELLYAPYIDKNAHILELLDSGQTELAAKKMKDYLELSERTVLAAYTRKNNE"
     MTMKKENSPQ ILSKKIAETI RNKLVIGELL PGQRLSEAIL SEQLEISRNT LREVFRVLTQ        60
     EGLLKHQPNR GVFVAIPDIA SIIDIYQVRR LIECQALTQA YSMHPSVAKM KEAVTSAQLY       120
     RNNQNWVGVG TANMHFHTAI VELTDSKRLI TFYRNISAEL RLAFGLLNDP ELLYAPYIDK       180
     NAHILELLDS GQTELAAKKM KDYLELSERT VLAAYTRKNN E                           221
//

If you have problems or comments...

PBIL Back to PBIL home page