(data stored in ACNUC1104 zone)

EMBL: FN667741.PE518

FN667741.PE518       Location/Qualifiers
FT   CDS             531307..532557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0529"
FT                   /product="putative Membrane protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79673"
FT                   /db_xref="GOA:D3UZ91"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79673.1"
FT                   /translation="MAIQETVKQETVNFVVNRRSSLMAAVFLMATSAIGPGFITQTATF
FT                   TATMGAAFAFGILASILIDFVVQQNIWRIVTLTKMQSADIANAAIPGSGYLLAALVMFG
FT                   GLVFNVGNIAGAGLGLNALIGLEPKWGGLLSALMAIYIFASRRAGVAIDRIIVVLGVVM
FT                   IGLTLFVAIVSNPPVGEALRQTVLPDDINFATITTIVGGTVGGYICYAGAHRLLDKGMT
FT                   GVENIDAVSSAATKGILAVGLMRYFLFLAILGVVASGVTLDIASETANPASQAFQVVAG
FT                   EFGLRIFGLILWSAAITSVIGAAYTSISFARVFKKQLTDRHLNIITLCFITLSLAVYLL
FT                   IGTPPAALLVFAGGFNGLILPLGLTIFVYVGWKRADLMGGYHYPRWLLWSGVVTCVLTW
FT                   YMGAMSISSIFAFLKAA"
     MAIQETVKQE TVNFVVNRRS SLMAAVFLMA TSAIGPGFIT QTATFTATMG AAFAFGILAS        60
     ILIDFVVQQN IWRIVTLTKM QSADIANAAI PGSGYLLAAL VMFGGLVFNV GNIAGAGLGL       120
     NALIGLEPKW GGLLSALMAI YIFASRRAGV AIDRIIVVLG VVMIGLTLFV AIVSNPPVGE       180
     ALRQTVLPDD INFATITTIV GGTVGGYICY AGAHRLLDKG MTGVENIDAV SSAATKGILA       240
     VGLMRYFLFL AILGVVASGV TLDIASETAN PASQAFQVVA GEFGLRIFGL ILWSAAITSV       300
     IGAAYTSISF ARVFKKQLTD RHLNIITLCF ITLSLAVYLL IGTPPAALLV FAGGFNGLIL       360
     PLGLTIFVYV GWKRADLMGG YHYPRWLLWS GVVTCVLTWY MGAMSISSIF AFLKAA           416
//

If you have problems or comments...

PBIL Back to PBIL home page