(data stored in ACNUC1104 zone)

EMBL: FN667741.PE520

FN667741.PE520       Location/Qualifiers
FT   CDS             533367..534965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /locus_tag="XBJ1_0531"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79675"
FT                   /db_xref="GOA:D3UZ93"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79675.1"
FT                   /translation="MRFLLVNFNTILVELSGLPETLALFDSLSIVPVLGIEEIIPAART
FT                   LMIRFRPTKISIHQLVAEIGHRDLHECSHPQGKQIEIPVHYNGDDLAEVAEILGCTAQD
FT                   VIRQHTENEYTVAFSGFAPGFAYMVSDMAQWNIPRRQTPRTRIPAGAVALAGEFSGIYP
FT                   QASPGGWQIIGITTERMWDLSRPDPALLQPGYRVNFRDAGRATVTVSLSETSRTNPVFQ
FT                   SETSRYLEIRSVGLQTLFQDLGRFGKSGLGISESGAMDKSALRSANRIVGNSSEQACLE
FT                   IVQGGFKAVACGQMMVAVTGALCPIEIKTPQGELIHVSAYKPIDLSDGDEIILGRPDAG
FT                   TRSYLAVRGGFTIPSVLSSRSFDTLSHIGPEPLKAEDKLVVGTTSHCAAVSFSETLAFV
FT                   MPNKNEIVVLDVLLGPRTDWFTQESIDLLRNQIWQVTPQSNRIGLRLNGECSLSRIKCQ
FT                   ELPSEGTCAGAIQIPASGQPVLFLSDHPLTGGYPVIASVAHYHLDLAGQIPVNAKIRFN
FT                   PIIQFHELSGSEDLR"
     MRFLLVNFNT ILVELSGLPE TLALFDSLSI VPVLGIEEII PAARTLMIRF RPTKISIHQL        60
     VAEIGHRDLH ECSHPQGKQI EIPVHYNGDD LAEVAEILGC TAQDVIRQHT ENEYTVAFSG       120
     FAPGFAYMVS DMAQWNIPRR QTPRTRIPAG AVALAGEFSG IYPQASPGGW QIIGITTERM       180
     WDLSRPDPAL LQPGYRVNFR DAGRATVTVS LSETSRTNPV FQSETSRYLE IRSVGLQTLF       240
     QDLGRFGKSG LGISESGAMD KSALRSANRI VGNSSEQACL EIVQGGFKAV ACGQMMVAVT       300
     GALCPIEIKT PQGELIHVSA YKPIDLSDGD EIILGRPDAG TRSYLAVRGG FTIPSVLSSR       360
     SFDTLSHIGP EPLKAEDKLV VGTTSHCAAV SFSETLAFVM PNKNEIVVLD VLLGPRTDWF       420
     TQESIDLLRN QIWQVTPQSN RIGLRLNGEC SLSRIKCQEL PSEGTCAGAI QIPASGQPVL       480
     FLSDHPLTGG YPVIASVAHY HLDLAGQIPV NAKIRFNPII QFHELSGSED LR               532
//

If you have problems or comments...

PBIL Back to PBIL home page