(data stored in ACNUC1104 zone)

EMBL: FN667741.PE547

FN667741.PE547       Location/Qualifiers
FT   CDS             complement(561644..562045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79702"
FT                   /db_xref="GOA:D3UZC0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79702.1"
FT                   /translation="MKLTIKPISVLSQQDKIDLKKIWPEQDTQEWEVLLAGDQKLFVAQ
FT                   FNGRLLAAVKVTLNSSTGILEDFCVREVTRRRGVGAYLLEQVKAAFPEINRWEWSLNHF
FT                   PDIHAPALRDFMDACDFRYDAQNNAYYYE"
     MKLTIKPISV LSQQDKIDLK KIWPEQDTQE WEVLLAGDQK LFVAQFNGRL LAAVKVTLNS        60
     STGILEDFCV REVTRRRGVG AYLLEQVKAA FPEINRWEWS LNHFPDIHAP ALRDFMDACD       120
     FRYDAQNNAY YYE                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page