(data stored in ACNUC1104 zone)

EMBL: FN667741.PE551

FN667741.PE551       Location/Qualifiers
FT   CDS             567579..570704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0110"
FT                   /locus_tag="XBJ1_0562"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79706"
FT                   /db_xref="GOA:D3UZC4"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79706.1"
FT                   /translation="MEKSILTSAGDALETAAKKVAETFEKMVDEAKARIPHELDMDTVV
FT                   RPCDANIRPVYPVRYAYMNFFGDTWIDAQLPPPISTFIDPDDDSLSASVLGGYSIRMPR
FT                   PGWIYVKEEGAIKTRGSQQNGNLLIFKFSPEIVTLEGKRGMVTKYTKYEQKAGSSSWEE
FT                   IHPASGTAGLGYPFLAIDKDVTQISLIYSEVELAKSVLNKMDNDKNFRKNAMQFVDLDS
FT                   EVSDYAIDARQEHFDGLVEDFKDPEKQFQAYKNQLSDPLLHAADLGDITTEGSFFMDAD
FT                   MEMRYIDSLICPYYKDKAKIVVLHDPVGYQRDILMAYMLLNLWELSYSATNMYPLTIGN
FT                   FVEILAASKNKEVKKCVEECIHQENWKTWWPKLTTPIKSVKDRKKEILEFYKCFSESEM
FT                   IAGKLGGLTHYFKNFFSVSDKKDIYTEGDAKEFERFCILHAELMEPLKHSEEGLLAMES
FT                   IIAGPLAIDGNSAWEVALNGIVNSLGHDGVDKGSIARFLNRGIDIILSVVGNLLARLYV
FT                   FTTELSYKGVLHLHVLSVKQVTHKLVPKILDYFGLEIKQGHYLELTEKEYYTFLKKIEE
FT                   YENQGVSGEIKKGMAHAESGLKRFVGKKVFDWSNRLDNYNNNIKIKIPLIKFKRPELNP
FT                   QFKFFYNANKSAGYLLSSGLSGLDLLMKSYMLYKLTSMSRFDKNAPFNANRLPYYYVSS
FT                   YANTILGGLIAAKGVSAIGGDAIKVAASLAGKLNSPAAKALLDSASRRLLLESALITKW
FT                   VNSGLIATGFVSGVLSYYDAYNSFSFGNDKEAYSHISIGTGSIIMAVGWSMAVAASEVT
FT                   FGVSLLIALGASLMLGGTFAAIYFNWIDLETLLSNCFWGNGSKYAFWSTSEKRLSLENQ
FT                   FKRIKIIDKEIKDIYLVEFQEFLNIFIKPTLNIENNKQGKVIYKFILPNFKWGKSDIYH
FT                   EVIPSALSDGYSDPDASIIERGYSRHHYSVVKDNFDKAIDIARKNRENLIYDEESGLTT
FT                   LTVEVDEKYSVYMKVFWYYKPTEDTVSPLHYKLGKEPILENAVYGYEDEVLR"
     MEKSILTSAG DALETAAKKV AETFEKMVDE AKARIPHELD MDTVVRPCDA NIRPVYPVRY        60
     AYMNFFGDTW IDAQLPPPIS TFIDPDDDSL SASVLGGYSI RMPRPGWIYV KEEGAIKTRG       120
     SQQNGNLLIF KFSPEIVTLE GKRGMVTKYT KYEQKAGSSS WEEIHPASGT AGLGYPFLAI       180
     DKDVTQISLI YSEVELAKSV LNKMDNDKNF RKNAMQFVDL DSEVSDYAID ARQEHFDGLV       240
     EDFKDPEKQF QAYKNQLSDP LLHAADLGDI TTEGSFFMDA DMEMRYIDSL ICPYYKDKAK       300
     IVVLHDPVGY QRDILMAYML LNLWELSYSA TNMYPLTIGN FVEILAASKN KEVKKCVEEC       360
     IHQENWKTWW PKLTTPIKSV KDRKKEILEF YKCFSESEMI AGKLGGLTHY FKNFFSVSDK       420
     KDIYTEGDAK EFERFCILHA ELMEPLKHSE EGLLAMESII AGPLAIDGNS AWEVALNGIV       480
     NSLGHDGVDK GSIARFLNRG IDIILSVVGN LLARLYVFTT ELSYKGVLHL HVLSVKQVTH       540
     KLVPKILDYF GLEIKQGHYL ELTEKEYYTF LKKIEEYENQ GVSGEIKKGM AHAESGLKRF       600
     VGKKVFDWSN RLDNYNNNIK IKIPLIKFKR PELNPQFKFF YNANKSAGYL LSSGLSGLDL       660
     LMKSYMLYKL TSMSRFDKNA PFNANRLPYY YVSSYANTIL GGLIAAKGVS AIGGDAIKVA       720
     ASLAGKLNSP AAKALLDSAS RRLLLESALI TKWVNSGLIA TGFVSGVLSY YDAYNSFSFG       780
     NDKEAYSHIS IGTGSIIMAV GWSMAVAASE VTFGVSLLIA LGASLMLGGT FAAIYFNWID       840
     LETLLSNCFW GNGSKYAFWS TSEKRLSLEN QFKRIKIIDK EIKDIYLVEF QEFLNIFIKP       900
     TLNIENNKQG KVIYKFILPN FKWGKSDIYH EVIPSALSDG YSDPDASIIE RGYSRHHYSV       960
     VKDNFDKAID IARKNRENLI YDEESGLTTL TVEVDEKYSV YMKVFWYYKP TEDTVSPLHY      1020
     KLGKEPILEN AVYGYEDEVL R                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page