(data stored in ACNUC1104 zone)

EMBL: FN667741.PE555

FN667741.PE555       Location/Qualifiers
FT   CDS             573430..573618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79710"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79710.1"
FT                   /translation="MSHRKGRLNLNNRWKNINTVSYIFSRKNSTEKYYNYLGAILKDSN
FT                   VFDKNPINKIGMFNLIL"
     MSHRKGRLNL NNRWKNINTV SYIFSRKNST EKYYNYLGAI LKDSNVFDKN PINKIGMFNL        60
     IL                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page