(data stored in ACNUC1104 zone)

EMBL: FN667741.PE561

FN667741.PE561       Location/Qualifiers
FT   CDS             complement(588227..589132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79716"
FT                   /db_xref="GOA:D3UWE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79716.1"
FT                   /translation="MPLIRLFREEDSTGVSALFRVVYGEDYVYPEVYLPTMLSRYNAAR
FT                   HWYSAVAIQNGQVLGHATLWRNGRCPSSAELSLIAVHPQARGQGIATALGRYLCDQAKE
FT                   MGLGMLTIKQVSSHNHSQRLAQNLGFHTTGLLPDYVISPFDQARPESIVLGCLPLQRWP
FT                   FPELHWPVNWQTWLTSVTQIFGQEPLKPAVPIDTGTRIASHGGRLEVWIETQTTERVKE
FT                   VTELPAHKLIYVKLPVGEETLHAVQILQQAGFACTGFVPGHHHRWEMLLVRGHSRKELT
FT                   LSCQFAHNLHQQSLFACAER"
     MPLIRLFREE DSTGVSALFR VVYGEDYVYP EVYLPTMLSR YNAARHWYSA VAIQNGQVLG        60
     HATLWRNGRC PSSAELSLIA VHPQARGQGI ATALGRYLCD QAKEMGLGML TIKQVSSHNH       120
     SQRLAQNLGF HTTGLLPDYV ISPFDQARPE SIVLGCLPLQ RWPFPELHWP VNWQTWLTSV       180
     TQIFGQEPLK PAVPIDTGTR IASHGGRLEV WIETQTTERV KEVTELPAHK LIYVKLPVGE       240
     ETLHAVQILQ QAGFACTGFV PGHHHRWEML LVRGHSRKEL TLSCQFAHNL HQQSLFACAE       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page