(data stored in ACNUC1104 zone)

EMBL: FN667741.PE562

FN667741.PE562       Location/Qualifiers
FT   CDS             complement(589147..590418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0113"
FT                   /locus_tag="XBJ1_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79717"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79717.1"
FT                   /translation="MTLSLHDLVEYARHHAPFFRDLYSDLPQSGWALTDLPLIDPAAYW
FT                   QQSQPLENWPVLTGPINSGHIFKTGGSTSEGRLSVFSRSEWQAFVRSFGQGLAQQLQSG
FT                   DRVANLFFAGDLYTSLLFIHGALSHSPVPVVEYPFTCSVEDQALADAIVSLGINVLAGV
FT                   PVQLLRFASTLQRSGQFMPNIDRLLYGGESLFPEQLALLNIVFPNARISSIGCASVDAG
FT                   LIGAASPDCHHGEHRVFDEDSIVEIIDESNGQPITESGRNGMLVVTNLQRRLMPVIRYP
FT                   TGDLACWCEGSGRLNRKFALQGRAGSAHRIRVSTLSLFPDQIARLLQQQKGILAWQLLL
FT                   SRQDGIDKITLLLASDSPQMPSTTSIHQALVTAQPAMAELCSQGGLQVEVASCALENMV
FT                   THPRSGKLIRVVDHRCYNAEEKTA"
     MTLSLHDLVE YARHHAPFFR DLYSDLPQSG WALTDLPLID PAAYWQQSQP LENWPVLTGP        60
     INSGHIFKTG GSTSEGRLSV FSRSEWQAFV RSFGQGLAQQ LQSGDRVANL FFAGDLYTSL       120
     LFIHGALSHS PVPVVEYPFT CSVEDQALAD AIVSLGINVL AGVPVQLLRF ASTLQRSGQF       180
     MPNIDRLLYG GESLFPEQLA LLNIVFPNAR ISSIGCASVD AGLIGAASPD CHHGEHRVFD       240
     EDSIVEIIDE SNGQPITESG RNGMLVVTNL QRRLMPVIRY PTGDLACWCE GSGRLNRKFA       300
     LQGRAGSAHR IRVSTLSLFP DQIARLLQQQ KGILAWQLLL SRQDGIDKIT LLLASDSPQM       360
     PSTTSIHQAL VTAQPAMAEL CSQGGLQVEV ASCALENMVT HPRSGKLIRV VDHRCYNAEE       420
     KTA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page