(data stored in ACNUC1104 zone)

EMBL: FN667741.PE57

FN667741.PE57        Location/Qualifiers
FT   CDS             complement(67920..68471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79212"
FT                   /db_xref="GOA:D3UY34"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79212.1"
FT                   /translation="MKSNYLVWFHRPAWQLFLLQQLPVIPLILGFYFWVWQENEYAIHD
FT                   LQLNLTEQKHNSALSEKRIAELPNLPDIRQQIQQLTAELSQGNNILPNNIPQKNATVLK
FT                   RLHQPLTSSGSQLMEWKSHREGNQIFWHIMLSLSYDQLLHFLNEIQQVQPVLLIKHLTI
FT                   IPVDNDLTVRMVLSDVLHEG"
     MKSNYLVWFH RPAWQLFLLQ QLPVIPLILG FYFWVWQENE YAIHDLQLNL TEQKHNSALS        60
     EKRIAELPNL PDIRQQIQQL TAELSQGNNI LPNNIPQKNA TVLKRLHQPL TSSGSQLMEW       120
     KSHREGNQIF WHIMLSLSYD QLLHFLNEIQ QVQPVLLIKH LTIIPVDNDL TVRMVLSDVL       180
     HEG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page