(data stored in ACNUC1104 zone)

EMBL: FN667741.PE574

FN667741.PE574       Location/Qualifiers
FT   CDS             complement(601271..601657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0116"
FT                   /locus_tag="XBJ1_0585"
FT                   /product="putative structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79729"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79729.1"
FT                   /translation="MYDNLKSLGITHPEDIDRYSLRQEANNDILKIYFRKDKGEFFAKS
FT                   VKFKYPRQLKTISDDNSAQGYKEVKEINTNLRYVIEELDQICRHDQVEVDLKHKILDDL
FT                   RHLEHVVANKIAEIEADLEKLTRK"
     MYDNLKSLGI THPEDIDRYS LRQEANNDIL KIYFRKDKGE FFAKSVKFKY PRQLKTISDD        60
     NSAQGYKEVK EINTNLRYVI EELDQICRHD QVEVDLKHKI LDDLRHLEHV VANKIAEIEA       120
     DLEKLTRK                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page