(data stored in ACNUC1104 zone)

EMBL: FN667741.PE58

FN667741.PE58        Location/Qualifiers
FT   CDS             complement(68461..69012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79213"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79213.1"
FT                   /translation="MMYQVNFLPWRQARLKRLCRKWGLLLCLQLILCISVLTFISVQQK
FT                   NKIAQHHDKLTEISHQLMQLQQNIQESEHAIQHHQQLTQQLRKKQTFMEQNQRYLQLFR
FT                   QLPHLLPEKSWLTAFSDDTGQLVFAASSQNYDDVSDLLDNLTDNASLNNVQLKKMSTTE
FT                   EHLKIFTIDANWLMGAPDEK"
     MMYQVNFLPW RQARLKRLCR KWGLLLCLQL ILCISVLTFI SVQQKNKIAQ HHDKLTEISH        60
     QLMQLQQNIQ ESEHAIQHHQ QLTQQLRKKQ TFMEQNQRYL QLFRQLPHLL PEKSWLTAFS       120
     DDTGQLVFAA SSQNYDDVSD LLDNLTDNAS LNNVQLKKMS TTEEHLKIFT IDANWLMGAP       180
     DEK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page