(data stored in ACNUC1104 zone)

EMBL: FN667741.PE59

FN667741.PE59        Location/Qualifiers
FT   CDS             complement(68837..68986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0013"
FT                   /locus_tag="XBJ1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79214"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79214.1"
FT                   /translation="MASGKIKTPMPEMGAIALPAINTLHICTNVYFRAAKKQNCATSRQ
FT                   INRN"
     MASGKIKTPM PEMGAIALPA INTLHICTNV YFRAAKKQNC ATSRQINRN                    49
//

If you have problems or comments...

PBIL Back to PBIL home page