(data stored in ACNUC1104 zone)

EMBL: FN667741.PE600

FN667741.PE600       Location/Qualifiers
FT   CDS             complement(632183..632890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0121"
FT                   /locus_tag="XBJ1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79755"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79755.1"
FT                   /translation="MADFHFTQIGTIHSPYKEKFAIPRQPGLVEDGAGQLELLAPYNQI
FT                   DAIRGIEQFSHLWIIFVFHQTMNGGWNPLVRPPRLGGNAKMGVFATRSTFRPNPIGMSL
FT                   VELKGIQCQNNRVILELGSLDLVDGTPVIDIKPYLPFAESRPEARAGFAQKAPDTGMEV
FT                   SFLPIAEHQLSSHQANYPHLRRFISQILAQDPRPAYRKKEQENRIYAVHILDFNVRWQI
FT                   RDAMTEVVSIEHR"
     MADFHFTQIG TIHSPYKEKF AIPRQPGLVE DGAGQLELLA PYNQIDAIRG IEQFSHLWII        60
     FVFHQTMNGG WNPLVRPPRL GGNAKMGVFA TRSTFRPNPI GMSLVELKGI QCQNNRVILE       120
     LGSLDLVDGT PVIDIKPYLP FAESRPEARA GFAQKAPDTG MEVSFLPIAE HQLSSHQANY       180
     PHLRRFISQI LAQDPRPAYR KKEQENRIYA VHILDFNVRW QIRDAMTEVV SIEHR            235
//

If you have problems or comments...

PBIL Back to PBIL home page