(data stored in ACNUC1104 zone)

EMBL: FN667741.PE605

FN667741.PE605       Location/Qualifiers
FT   CDS             complement(636700..637338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0123"
FT                   /locus_tag="XBJ1_0616"
FT                   /product="putative amino acid efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79760"
FT                   /db_xref="GOA:D3UWI6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79760.1"
FT                   /translation="MLSNYWGEFLGLAMIHFLAVVAPGPDFAVTIQQSVKFGRLAGVCT
FT                   AIGIGAGISVHVVYTLVGISSLMHSTPWLMEMAKLVGSLYIIWLGIKFIKSKPVNPDTL
FT                   ESKNIIQTSQSKWQAFLMGFMTNALNPKATLFFLAVFTTVVSINTPILIQVFYGLWMCI
FT                   ANTVWFVLVSVIFSNVLIRNKFMEKGYWFERVMGIVLISFAIRLLFISV"
     MLSNYWGEFL GLAMIHFLAV VAPGPDFAVT IQQSVKFGRL AGVCTAIGIG AGISVHVVYT        60
     LVGISSLMHS TPWLMEMAKL VGSLYIIWLG IKFIKSKPVN PDTLESKNII QTSQSKWQAF       120
     LMGFMTNALN PKATLFFLAV FTTVVSINTP ILIQVFYGLW MCIANTVWFV LVSVIFSNVL       180
     IRNKFMEKGY WFERVMGIVL ISFAIRLLFI SV                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page