(data stored in ACNUC1104 zone)

EMBL: FN667741.PE606

FN667741.PE606       Location/Qualifiers
FT   CDS             complement(637340..638110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0123"
FT                   /locus_tag="XBJ1_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79761"
FT                   /db_xref="GOA:D3UWI7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79761.1"
FT                   /translation="MIIETDRLNSACIEKLAKQEILAIRIKKFIPTSLAEKISEKILGK
FT                   GFDKYLNAPSIGRIGMAFYETENKALRVADYFENVLNNINELRQRCSPYLSPIDQLRCV
FT                   LDEVWPAGAQLETLYGKKMYVGLSRVVEPGVTFLAHHDIFAKDAPDSFRAKSLQAQFAA
FT                   NVYLSMPNEGGALQVWKNKLSPEEFDSMRRDSYGIEPSLLGKPALEVQPDAGELLIFNA
FT                   QCMHAVTAGIGSSRLSLSCFIGYRGEAAPLSFWS"
     MIIETDRLNS ACIEKLAKQE ILAIRIKKFI PTSLAEKISE KILGKGFDKY LNAPSIGRIG        60
     MAFYETENKA LRVADYFENV LNNINELRQR CSPYLSPIDQ LRCVLDEVWP AGAQLETLYG       120
     KKMYVGLSRV VEPGVTFLAH HDIFAKDAPD SFRAKSLQAQ FAANVYLSMP NEGGALQVWK       180
     NKLSPEEFDS MRRDSYGIEP SLLGKPALEV QPDAGELLIF NAQCMHAVTA GIGSSRLSLS       240
     CFIGYRGEAA PLSFWS                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page