(data stored in ACNUC1104 zone)

EMBL: FN667741.PE607

FN667741.PE607       Location/Qualifiers
FT   CDS             complement(638893..638985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0124"
FT                   /locus_tag="XBJ1_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79762"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79762.1"
FT                   /translation="MKYTPFGFDIAKHLMQVHFVDEYTSEVVDK"
     MKYTPFGFDI AKHLMQVHFV DEYTSEVVDK                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page