(data stored in ACNUC1104 zone)

EMBL: FN667741.PE619

FN667741.PE619       Location/Qualifiers
FT   CDS             complement(652443..652829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79774"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79774.1"
FT                   /translation="MGGSQALALDFSYKSEMPADNKPSEEYLKKRAGLESKSWNVDTLT
FT                   QDNVLAEKREEEMGQYNKKFENKNGIGLSYDWESKHLKSLQHMQQTSHFSNRRCYRATR
FT                   QKLEKDFGNGYSYSDIADTCGSFH"
     MGGSQALALD FSYKSEMPAD NKPSEEYLKK RAGLESKSWN VDTLTQDNVL AEKREEEMGQ        60
     YNKKFENKNG IGLSYDWESK HLKSLQHMQQ TSHFSNRRCY RATRQKLEKD FGNGYSYSDI       120
     ADTCGSFH                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page