(data stored in ACNUC1104 zone)

EMBL: FN667741.PE7

FN667741.PE7         Location/Qualifiers
FT   CDS             7006..7782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0002"
FT                   /locus_tag="XBJ1_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79162"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79162.1"
FT                   /translation="MLKRNNSFKDYISKIQSESLSRSKSFHSLPPDNILKANVNYNNPR
FT                   LINGYIPTVRETSLEEIINAVKHIYKSIKEDRWTSHIKNVTERKNEIFQKNQKTREDAW
FT                   DMRCCMTDNLLEKLQGILTILLKNGYFKTHAYFVCYINTQPIGVMLLKKYNSLYSRGTA
FT                   YYPEVNFIINHPGIQNCAYLLMEKAVNTSYKIGYQGKLKLTLATGELSSKVYQKMGFTH
FT                   IKGDENMKMELNPNGNSVWYLSPSYGGYFFTGIRRD"
     MLKRNNSFKD YISKIQSESL SRSKSFHSLP PDNILKANVN YNNPRLINGY IPTVRETSLE        60
     EIINAVKHIY KSIKEDRWTS HIKNVTERKN EIFQKNQKTR EDAWDMRCCM TDNLLEKLQG       120
     ILTILLKNGY FKTHAYFVCY INTQPIGVML LKKYNSLYSR GTAYYPEVNF IINHPGIQNC       180
     AYLLMEKAVN TSYKIGYQGK LKLTLATGEL SSKVYQKMGF THIKGDENMK MELNPNGNSV       240
     WYLSPSYGGY FFTGIRRD                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page