(data stored in ACNUC1104 zone)

EMBL: FN667741.PE70

FN667741.PE70        Location/Qualifiers
FT   CDS             81989..82468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0015"
FT                   /locus_tag="XBJ1_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79225"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79225.1"
FT                   /translation="MSYMIYLTLNGKKQGLISAGCSTLDSIGNRYQKGHEDQIQVLSLN
FT                   HAISRQQNVSHQPIQFIKPIDKSSPLLAMAIDSNESLNGGFIFYRTSQTGQLELFYEVK
FT                   ITEATITDISCVYPHSINDHDMMPYEKVTLNYKSISWNHITAGTSAYIPVVIEDA"
     MSYMIYLTLN GKKQGLISAG CSTLDSIGNR YQKGHEDQIQ VLSLNHAISR QQNVSHQPIQ        60
     FIKPIDKSSP LLAMAIDSNE SLNGGFIFYR TSQTGQLELF YEVKITEATI TDISCVYPHS       120
     INDHDMMPYE KVTLNYKSIS WNHITAGTSA YIPVVIEDA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page