(data stored in ACNUC1104 zone)

EMBL: FN667741.PE73

FN667741.PE73        Location/Qualifiers
FT   CDS             complement(84050..84223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79228"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79228.1"
FT                   /translation="MIVFGLVVAGVLYYLDDKYQVSEKLIEALRNEEAKKRFREHLANP
FT                   KYNMPRPPIFYR"
     MIVFGLVVAG VLYYLDDKYQ VSEKLIEALR NEEAKKRFRE HLANPKYNMP RPPIFYR           57
//

If you have problems or comments...

PBIL Back to PBIL home page