(data stored in ACNUC1104 zone)

EMBL: FN667741.PE76

FN667741.PE76        Location/Qualifiers
FT   CDS             86667..87440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79231"
FT                   /db_xref="GOA:D3UY53"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79231.1"
FT                   /translation="MVQNRSSRDLVSRAHHELFTDRDVRALERYFAPNFIEHSPLVKEG
FT                   FAGLRERVQAHPELHHEMYRVLQDGDLVAIHGRFTGLDEQPLVGFDLYRVADGLIVEHW
FT                   DGLVPQSAPNTSGRTQLDGPTETGYSHDREKNRELVVNFFTRTLIEEHYDEFGNYTNGE
FT                   EFRQHSPDIPDGTVAVIEFLKQLKDEGQGLHYAKIHHTVADGQFVLSHSEGSIAGVRHS
FT                   YFELWRIENGKVAELWDAITPVPEDAQALHRHGMF"
     MVQNRSSRDL VSRAHHELFT DRDVRALERY FAPNFIEHSP LVKEGFAGLR ERVQAHPELH        60
     HEMYRVLQDG DLVAIHGRFT GLDEQPLVGF DLYRVADGLI VEHWDGLVPQ SAPNTSGRTQ       120
     LDGPTETGYS HDREKNRELV VNFFTRTLIE EHYDEFGNYT NGEEFRQHSP DIPDGTVAVI       180
     EFLKQLKDEG QGLHYAKIHH TVADGQFVLS HSEGSIAGVR HSYFELWRIE NGKVAELWDA       240
     ITPVPEDAQA LHRHGMF                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page