(data stored in ACNUC1104 zone)

EMBL: FN667741.PE78

FN667741.PE78        Location/Qualifiers
FT   CDS             88286..89035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79233"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79233.1"
FT                   /translation="MYNDIHVERARSILNDILVTAQQATAALADKTARILLELPLCHTV
FT                   GVRLAREQRGALQKHIHDVLRNNVWCNGAGFASYAVPKTVGKEGYWTLEWWRQEGDTIQ
FT                   YAPLEHNQEQRRRLDFRLFEWFRQPANCHLPVIDGPYVDYVCNGAYTITIAHPVLIGEE
FT                   FAGVAAVDMLVSTLDRLLLPALGAIGKPALIINDDARVVTSTVPGVRSGSLLKSQGVNR
FT                   SVDGEVPSLRLVILPSSHTESHRAFVC"
     MYNDIHVERA RSILNDILVT AQQATAALAD KTARILLELP LCHTVGVRLA REQRGALQKH        60
     IHDVLRNNVW CNGAGFASYA VPKTVGKEGY WTLEWWRQEG DTIQYAPLEH NQEQRRRLDF       120
     RLFEWFRQPA NCHLPVIDGP YVDYVCNGAY TITIAHPVLI GEEFAGVAAV DMLVSTLDRL       180
     LLPALGAIGK PALIINDDAR VVTSTVPGVR SGSLLKSQGV NRSVDGEVPS LRLVILPSSH       240
     TESHRAFVC                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page