(data stored in ACNUC1104 zone)

EMBL: FN667741.PE81

FN667741.PE81        Location/Qualifiers
FT   CDS             90862..92403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0085"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79236"
FT                   /db_xref="GOA:D3UY58"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79236.1"
FT                   /translation="MAMNRRDFISTTAALAGAGVLSSLLPTTSLLARTLTAADASAVNI
FT                   DQLRPTLLKDAQYRTSRLGLDPRIWNWHRDVAATAMPANYYEASLADWPAFGSFPIDQN
FT                   CEVVVIGGGLLGASTALHLAEAGVDVILVEKDNIGSGASGRNGGQMTPGIARWEAETML
FT                   EKLSPDEAKRLWRFASVEAMNLVDELRERYGFECDRKYGHITAAIHPGHMGPLVANADA
FT                   RRQLGDTAVKVIGPHELQERYVRSGIYHGANIDSIGGQVQPLALLRGLIYSFAKLGGRV
FT                   YDGTKVKGIRQDASSAVIETERGVIRASKAVVLGVHGSTEEFISGPSTTVPFFTYVAVT
FT                   PPLPVDIKELIPSDLPVYDTQLQIDYYRAVRDNRLLFGGQGTGNSWSSRDVNNYLLERI
FT                   RTVFPQLEKPELEYSWGGISDLTLNGATDARKSGDSVPVYMVHGWSGHGVAQTVRIGKA
FT                   ISDDLTERNHDFTMLTRIEHSSIPLGSYFSPVAIPLIKGALGVINTVNPADMVSF"
     MAMNRRDFIS TTAALAGAGV LSSLLPTTSL LARTLTAADA SAVNIDQLRP TLLKDAQYRT        60
     SRLGLDPRIW NWHRDVAATA MPANYYEASL ADWPAFGSFP IDQNCEVVVI GGGLLGASTA       120
     LHLAEAGVDV ILVEKDNIGS GASGRNGGQM TPGIARWEAE TMLEKLSPDE AKRLWRFASV       180
     EAMNLVDELR ERYGFECDRK YGHITAAIHP GHMGPLVANA DARRQLGDTA VKVIGPHELQ       240
     ERYVRSGIYH GANIDSIGGQ VQPLALLRGL IYSFAKLGGR VYDGTKVKGI RQDASSAVIE       300
     TERGVIRASK AVVLGVHGST EEFISGPSTT VPFFTYVAVT PPLPVDIKEL IPSDLPVYDT       360
     QLQIDYYRAV RDNRLLFGGQ GTGNSWSSRD VNNYLLERIR TVFPQLEKPE LEYSWGGISD       420
     LTLNGATDAR KSGDSVPVYM VHGWSGHGVA QTVRIGKAIS DDLTERNHDF TMLTRIEHSS       480
     IPLGSYFSPV AIPLIKGALG VINTVNPADM VSF                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page