(data stored in ACNUC1104 zone)

EMBL: FN667741.PE98

FN667741.PE98        Location/Qualifiers
FT   CDS             complement(110167..110703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79253"
FT                   /db_xref="GOA:D3UY75"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79253.1"
FT                   /translation="MSKLIYYVAATMDGYIATEDHGLGWLEAFTLGDDATPYDEFYQGI
FT                   GAAIMGAGTYEWIMKNTSGDWPYQDIPSFILSSRNISIPPGISAVVTHTSTNDIAAEAR
FT                   AAAKGKNVWMIGGGKTAASFADAGELQQLFITTIPIFLGSGIRVLPVNKPIHVTSDKRR
FT                   FLRSGAIETIMDIKW"
     MSKLIYYVAA TMDGYIATED HGLGWLEAFT LGDDATPYDE FYQGIGAAIM GAGTYEWIMK        60
     NTSGDWPYQD IPSFILSSRN ISIPPGISAV VTHTSTNDIA AEARAAAKGK NVWMIGGGKT       120
     AASFADAGEL QQLFITTIPI FLGSGIRVLP VNKPIHVTSD KRRFLRSGAI ETIMDIKW         178
//

If you have problems or comments...

PBIL Back to PBIL home page