(data stored in ACNUC1104 zone)

EMBL: FN667741.POTB

FN667741.POTB        Location/Qualifiers
FT   CDS             471227..472087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potB"
FT                   /locus_tag="XBJ1_0472"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79621"
FT                   /db_xref="GOA:D3UWB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79621.1"
FT                   /translation="MKKTRKLFQNIVITGMVSWLMLFVFMPNLMIIGTSFLTRDDANLV
FT                   QMVFSLDNYSRLFDPLYAEVLLHSLNMAIVATLCCLVIGYPFAFFLARMPEKLRPLMLF
FT                   LLIVPFWTNSLIRIYGLKMFLSTRGYLNDFLLWLGIVDKPLRIMYTSEAVVLGLVYILL
FT                   PFMVMPLYSSIEKLDKPCLEAARDLGAGKLQTFIRIIIPLTMPGIIAGCLLVLLPAMGL
FT                   FYVADLMGGAKNLLIGNVIKSQFLNIRDWPFGAATSICLTLVMGLMLLVYYRAAKLLNK
FT                   KVELE"
     MKKTRKLFQN IVITGMVSWL MLFVFMPNLM IIGTSFLTRD DANLVQMVFS LDNYSRLFDP        60
     LYAEVLLHSL NMAIVATLCC LVIGYPFAFF LARMPEKLRP LMLFLLIVPF WTNSLIRIYG       120
     LKMFLSTRGY LNDFLLWLGI VDKPLRIMYT SEAVVLGLVY ILLPFMVMPL YSSIEKLDKP       180
     CLEAARDLGA GKLQTFIRII IPLTMPGIIA GCLLVLLPAM GLFYVADLMG GAKNLLIGNV       240
     IKSQFLNIRD WPFGAATSIC LTLVMGLMLL VYYRAAKLLN KKVELE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page