(data stored in ACNUC1104 zone)

EMBL: FN667741.POTC

FN667741.POTC        Location/Qualifiers
FT   CDS             472084..472863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potC"
FT                   /locus_tag="XBJ1_0473"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79622"
FT                   /db_xref="GOA:D3UWB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79622.1"
FT                   /translation="MIGRLLRGGFMTLVYAYLYIPIVILIVSSFNQSRFGISWQGFTTE
FT                   WYNLLFNNDSLLQAAGHSLTMAVTSATFATLIGSLTAVALYRYSFRGKKFVSGMLFVVM
FT                   MSPDIVMAISLLVLFMLLGVSLGFWSLLFSHITFCLPFVVVTVYSRLKDFDVKMLEAAR
FT                   DLGAGELTILRKIILPLAMPAVMAGWLLSFTLSMDDVVVSSFVTGPSYEILPLKIYSMV
FT                   KVGVSPEVNALATILLVMSLILVLFSQFIMRDRTGKA"
     MIGRLLRGGF MTLVYAYLYI PIVILIVSSF NQSRFGISWQ GFTTEWYNLL FNNDSLLQAA        60
     GHSLTMAVTS ATFATLIGSL TAVALYRYSF RGKKFVSGML FVVMMSPDIV MAISLLVLFM       120
     LLGVSLGFWS LLFSHITFCL PFVVVTVYSR LKDFDVKMLE AARDLGAGEL TILRKIILPL       180
     AMPAVMAGWL LSFTLSMDDV VVSSFVTGPS YEILPLKIYS MVKVGVSPEV NALATILLVM       240
     SLILVLFSQF IMRDRTGKA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page