(data stored in ACNUC1104 zone)

EMBL: FN667741.PSTC

FN667741.PSTC        Location/Qualifiers
FT   CDS             181352..182308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstC"
FT                   /locus_tag="XBJ1_0189"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79340"
FT                   /db_xref="GOA:D3UYG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79340.1"
FT                   /translation="MAERKTALKAPSKNGDIIFSALVRLAALMTLFLLGGIIISLIIAA
FT                   WPSIKTFGFGFLWNKDWDAPAEQFGALVPIYGTLVTSLIALIIAVPVSFGIALFLTELA
FT                   PNWLKRPLGVAVELLAAIPSIVYGMWGLFVFAPLFATYFQQPVGDVLSSIPIVGELFSG
FT                   PAFGIGILTAGIILAIMIIPYIASVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPY
FT                   TKNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSLSLYMPGNSITSALANEFAEAESG
FT                   LHTAALMELGLILFVITFIVLALSKLMILRLAKNEGR"
     MAERKTALKA PSKNGDIIFS ALVRLAALMT LFLLGGIIIS LIIAAWPSIK TFGFGFLWNK        60
     DWDAPAEQFG ALVPIYGTLV TSLIALIIAV PVSFGIALFL TELAPNWLKR PLGVAVELLA       120
     AIPSIVYGMW GLFVFAPLFA TYFQQPVGDV LSSIPIVGEL FSGPAFGIGI LTAGIILAIM       180
     IIPYIASVMR DVFEQTPVMM KESAYGIGCT TWEVIWRIVL PYTKNGVIGG VMLGLGRALG       240
     ETMAVTFIIG NTYQLDSLSL YMPGNSITSA LANEFAEAES GLHTAALMEL GLILFVITFI       300
     VLALSKLMIL RLAKNEGR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page